PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G083800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 957aa    MW: 105423 Da    PI: 5.2987
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G083800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.63.8e-205096148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++l +av+ + g++Wk+Ia+ ++ gRt+ qc +rwqk+l
  Sobic.009G083800.1.p 50 KGNWTPEEDDILREAVETYKGKNWKKIAESFP-GRTDVQCLHRWQKVL 96
                          79******************************.************986 PP

2Myb_DNA-binding62.67.9e-20102148148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g+W++eEde++++ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Sobic.009G083800.1.p 102 KGPWSKEEDEIIIQMVNKHGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                           79******************************.*************97 PP

3Myb_DNA-binding47.25.1e-15154196145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           +++WT++E+ +l++a++ +G++ W+   + ++ gRt++ +k++w+
  Sobic.009G083800.1.p 154 KDAWTQDEEIRLIHAHQTYGNK-WAELTKFLP-GRTDNAIKNHWH 196
                           679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.4624596IPR017930Myb domain
SuperFamilySSF466891.0E-1647103IPR009057Homeodomain-like
SMARTSM007171.4E-184998IPR001005SANT/Myb domain
PfamPF002493.0E-185096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2551109IPR009057Homeodomain-like
CDDcd001678.96E-165296No hitNo description
PROSITE profilePS5129432.5797152IPR017930Myb domain
SuperFamilySSF466893.59E-3199195IPR009057Homeodomain-like
SMARTSM007179.3E-19101150IPR001005SANT/Myb domain
PfamPF002493.6E-18102148IPR001005SANT/Myb domain
CDDcd001671.69E-16104148No hitNo description
Gene3DG3DSA:1.10.10.601.3E-26110155IPR009057Homeodomain-like
SMARTSM007172.5E-13153201IPR001005SANT/Myb domain
PROSITE profilePS5129418.884153203IPR017930Myb domain
PfamPF002495.4E-13154196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-21156203IPR009057Homeodomain-like
CDDcd001673.77E-10156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 957 aa     Download sequence    Send to blast
MMTGEKQMTS KGTESSSSSV PPDGVVSREP QKGGRLPNGR TTGPARRSSK GNWTPEEDDI  60
LREAVETYKG KNWKKIAESF PGRTDVQCLH RWQKVLNPEL VKGPWSKEED EIIIQMVNKH  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP GINKDAWTQD EEIRLIHAHQ TYGNKWAELT  180
KFLPGRTDNA IKNHWHSSVK KKVDSYRSSG LLAQFQGLTP VEYTPGGLNV DSSSAMTNQI  240
SEDSGFNVFR EAEDSMELSQ SSFAKGSCSQ EEQTDVTLGS HLHVHESLCQ DGFNNAENGA  300
SALPDMHHHL STSDMDQDKH LQEGMDLDKH LQLEFSQGID LHLDTDEVPN NFVIRDSQAS  360
NELAVQFQDR QTMNSSENDG VSLIPYAVTP CVPILPSVSG CEHNINVMSE VGIKNDNCFQ  420
SEKWQDISIQ SGAYSSEAAS NFSAPLYPLQ TAEPVTMMGG PVYYQSSVTS LPPDFISSDG  480
ASNASGVKFE TNHNPVSRQG LEIKTCHNPS GDPDQNSYMC SEDDRNRTSE PMDSIPESEK  540
EQQVDVEQSC LEPAAYSFKE PLSSHGDTIL NEKEDAGALC YEPPCFPSFE VPFVSCELVN  600
SSDLPEYSPL GIRELMRTTL NFPTPVRLWG SPPRDGSPDA VLKNAAKRFV CTPSIMKKRP  660
RDLSSPGPDI RNEKKSNTEK DCRSSGMSST RVGKSCMDSP DDSADLVSPK ETTAFQKNVK  720
LSHENKENLN GITDQGENEG NAKHSTGILT KSSVDNHNTP KHGPNFQSQG LNTSAQVSNS  780
KDIIFSRSKP SELLVDKSAA CVDADYEYVN ILADTPGIKR GLESPSAWKS PLFTPFPDAY  840
FMSPASRAFD ALGLVKQINE QSAAAVEEAH EVLASGGPWK RHNKENSDKE NIENTTLKHE  900
HVTSKPPSIL MAEARVLDFN ECSTPVRKKE DKKSEIALGG SSSSPVTSSY LRMNLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-65502036159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-65502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.75200.0leaf| ovary| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0171280.0BT017128.1 Zea mays clone EL01N0365C01.c mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008649478.10.0PREDICTED: uncharacterized protein LOC103630174 isoform X1
RefseqXP_008649477.10.0PREDICTED: uncharacterized protein LOC103630174 isoform X1
TrEMBLC5YV470.0C5YV47_SORBI; Putative uncharacterized protein Sb09g007380
STRINGSb09g007380.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-101myb domain protein 3r-4